PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G473800.1.p
Common NameLOC101782144, SETIT_034363mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 762aa    MW: 84405.4 Da    PI: 6.2849
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G473800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.57.1e-095193347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        +WT +E+e + +a +q G++ +++I ++++  +   q++++++ +
  Seita.9G473800.1.p 51 AWTRQEEENFFNALRQVGKN-FEKITHRVQ-SKNKDQVRHYYYRL 93
                        6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.77E-104397IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-54696IPR009057Homeodomain-like
PROSITE profilePS5129313.1674798IPR017884SANT domain
SMARTSM007175.1E-74896IPR001005SANT/Myb domain
CDDcd001678.93E-75194No hitNo description
PfamPF002499.4E-75193IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 762 aa     Download sequence    Send to blast
MEKEVHEELN PLLQTIEFAP STSDPNQKLD SAQPSDPNRK PAKKPTRQWA AWTRQEEENF  60
FNALRQVGKN FEKITHRVQS KNKDQVRHYY YRLVRRMKKL LGPGFSLDAK NSKDTIAAML  120
RWWSLLEKFS CSASKLHLKP RRFKTFVEAL GNQLLKDRNK SRRKCPRVDM CVSSPSPIVG  180
KTPGNEAFPL KFLPVDAQNG SRVASPKGAF FKRMAETNSS KSGATKGDLS ATRTVKQKRR  240
AGGVVASAAY KKWERAAMAG VSLVADAAEE LERNTINPGM LCNVDARTLT SSSDKLSTVD  300
GISTNHMKEA DSQAPAKLKL QLFPINEATR KALEKDEHNP HLELTLSSRK KISSVLEHLN  360
RKWGNSNIAS GELILFPYCA HQEDLATYQR WTTRDTVAVA DVFLSVNSPS VFRLRYGWFS  420
LVELEAGVSE ISLTHFENCM MPEDIQVKSP SGDKSCVQKD DALLSSNIHE QYPCSSIDQS  480
ALLHITPSST GKITELPEQT PSQFGSQKQV RVPVTQAFED DQGMNCAAIS EGEWADTLTD  540
ISVGYLLTEA SKGTHLDCIG TSSVKNALLL ENPCSYDSFD AAVALHVSRF QASEQPAHTP  600
HSTIWGGEET CDEFSFNLSA SRKQEGSNTP SSSSPDTDNE VHPLNSEGFQ GFLQDLTGGE  660
AAADNPCNDD GKDREEFCAK SPPRNDDTND LKDQSLADIY WPDSLGPLDL DIPSSRYQAD  720
DLIIGDSQNS WNRMMANSLD AFRNLSFFSS VDKNDSIPSI M*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7284240.0KJ728424.1 Zea mays clone pUT6729 MYB-related transcription factor (MYBR54) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985049.10.0PREDICTED: TSL-kinase interacting protein 1
TrEMBLK4A6590.0K4A659_SETIT; Uncharacterized protein
STRINGSi034363m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54783643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.31e-178TSL-kinase interacting protein 1